SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410659958|ref|YP_006912329.1| from Dehalobacter sp. CF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410659958|ref|YP_006912329.1|
Domain Number 1 Region: 12-232
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.19e-53
Family PP-loop ATPase 0.0001
Further Details:      
 
Domain Number 2 Region: 383-454
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000915
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 215-307
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000314
Family MesJ substrate recognition domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410659958|ref|YP_006912329.1|
Sequence length 469
Comment tRNA(Ile)-lysidine synthetase [Dehalobacter sp. CF]
Sequence
MYESLSSEVLPQQIPSQSKVLVAVSGGPDSVALAHVIYRYSCENQDKNISFVITHVNHKV
RREADEEAELVKNLAGEWKAGFILHEFDAKRNASACHQSFQEASREWRYARWKEDMEAWG
CDLLATAHHLGDQAETVLYRLLRGSGTTGLAGIYPVKDKIIRPLLSVTKEEILEYCKVQN
LPYSIDKSNLETDYYRNKIRLELIPELESKYNQRITDALGRTAELLRWDEEYICAQTEAL
WPRYCLRADHTGVLLSHEAWKEPEAILSRLLRKAASQVSGETRGPAFKFVKLWMQKGQQT
GWRQDLQGFKVEVVKQGLFFFNVERESKEYISGKDRIEEFRLFVKLPLALNVWNEITELK
VQVGIFDFYPEEQHVLWSTELDRSQMSVQTKPLVCRTRQAGDRIYFKNLGHKAIKKVFQD
KDIPAGERDKILFFAFGDLVVWIPGVCRGDSLLPAGPQSPRLYLVAAEV
Download sequence
Identical sequences K4L1M3
gi|410659958|ref|YP_006912329.1| gi|410656920|ref|YP_006909291.1| WP_015042350.1.6016 WP_015042350.1.71633 WP_015042350.1.88763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]