SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410660413|ref|YP_006912784.1| from Dehalobacter sp. CF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410660413|ref|YP_006912784.1|
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily Hsp33 domain 1.28e-75
Family Hsp33 domain 0.0000000237
Further Details:      
 
Domain Number 2 Region: 231-289
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 7.59e-21
Family HSP33 redox switch-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410660413|ref|YP_006912784.1|
Sequence length 292
Comment Chaperonin (heat shock protein 33) [Dehalobacter sp. CF]
Sequence
MNDYLIKALGYDGKVRAYAALTTETVGEAQRRHQTWPTASAALGRTLTAGLMLGAMLKGD
EQLTVKIEGNGPLGIILVDANAHGEVRGYVTNPQTHLDLNRIGKLDVSGAVGSEGTLSVV
KDLGMRDYFTGQVTLYSGEIGEDFTYYLVKSEQIPSSVGLGVLVAPDNTIQASGGFIIQL
LPGTAEETISEIEEHLKTITPVSTMIQHGFTPEEMLEEILGKNNVQVLEKMPVKFQCQCS
KERIGNAMISLGKEEIKEIIQTDGQAEVQCHFCNEMYLFSKEELEKLRNAAK
Download sequence
Identical sequences K4L2Z9 T2RLM8
gi|410657377|ref|YP_006909748.1| WP_015042804.1.6016 WP_015042804.1.71633 WP_015042804.1.88763 gi|410660413|ref|YP_006912784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]