SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410662263|ref|YP_006914634.1| from Dehalobacter sp. CF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410662263|ref|YP_006914634.1|
Domain Number 1 Region: 506-690
Classification Level Classification E-value
Superfamily Fibronectin type III 1.38e-26
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 31-202
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000201
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|410662263|ref|YP_006914634.1|
Domain Number - Region: 225-285
Classification Level Classification E-value
Superfamily DNA topoisomerase IV, alpha subunit 0.0196
Family DNA topoisomerase IV, alpha subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410662263|ref|YP_006914634.1|
Sequence length 690
Comment N-acetylmuramoyl-L-alanine amidase [Dehalobacter sp. CF]
Sequence
MGEIRSKSLVILLCFLVNFLTMPQISAAALSAPTNLSASTLSPNEIALTWTIVNGADKYN
IYRSTSHSGTYSFTNSVTTNQYTDTGLTSSQTYYYKVQTADNNETSALSSYAGATTLASF
SSLSAKSSGPGQIYLSWNSISGMTSYAVYRSASYSGTYTEISSTVYTNYTDGSLTSGNTY
YYKIKAVGSSGIGYFSNIVNATAGSPGSSFITSNRLSGSDRYETSALISQYGWSSSSYAV
IVNGENYPDALCSAPLASKYNAPILLTSSGSLSAKTRTELSRLHVSHVFLIGGTSAISTS
VEREIYYMGISISRIAGSDRYDTSVRIAQTLGSYSQAIIATGENFADALSAAPIAAIKEI
PILLTAKNSLPGNIQQALQNVTSTYVVGGTGVISISVLNLLPAGKRLSGADRYETNLKII
NEFSAQLNLAACCIATGQSFPDALAGSALAAQTNSPVILVNTLTNTSAGNYISQKSDLIS
KLIVFGGTAVIPQNVVNTLLDDIASVPAAPANLTAKSQSIHQIALSWPTVNGATSYAVYR
ASSYSGSFFQIATLSSTSYINNGLSANTTYYYKIKAMNGTGSSAFSPVASATTALSVPSA
PTNLTATSKSSSQITLSWSSVSGAASYSIYRASSPEGTYSAIAENVAAPPYTDTGLDRET
TYYYKIIALNSSGQSGLSAEASATTQAAVP
Download sequence
Identical sequences K4L889 T0I4E2
gi|410662263|ref|YP_006914634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]