SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY50947 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY50947
Domain Number 1 Region: 11-234
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.03e-83
Family Inorganic pyrophosphatase 0.000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY50947
Sequence length 284
Comment pep:novel supercontig:GCA_000004155.2:supercont4.5:842107:845413:1 gene:SPOG_04963 transcript:EPY50947 description:"inorganic diphosphatase"
Sequence
MSSARAITNFLTKYKGRLHTPDFGAYCFNKEKPVSFLHDIPLSSQEGTLNLVVEIPRWTQ
AKCEISNSVPLNPIMHDIKNKKIRYVQNCFPYHGYIWNYGAFPQTFEDPVKLDARTNLKG
DGDPIDVCEIGGSIGYIGQIKQVKVLGALALLDQNETDWKILTIDINDPMANSLNDIDDV
KKIMPRLLTCTRDWFAVYKIPDGKSKNTFGLSGEFLPKSVAKEIINECHTSWKMSSQRAD
HIHSFLTNSEKATQITQHLEERKESSFPGTSSFPSIGYYYQLRE
Download sequence
Identical sequences S9X1D1
EPY50947 XP_013024605.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]