SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY51022 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51022
Domain Number 1 Region: 113-355
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.57e-70
Family Glutamine synthetase catalytic domain 0.0015
Further Details:      
 
Domain Number 2 Region: 27-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 6.02e-17
Family Glutamine synthetase, N-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY51022
Sequence length 360
Comment pep:novel supercontig:GCA_000004155.2:supercont4.5:1000775:1002319:-1 gene:SPOG_04889 transcript:EPY51022 description:"glutamate-ammonia ligase Gln1"
Sequence
MCQYEVDPLLSKASIMAKYANLEPLDGKVMAEYIWIDGFNHIRSKTMTLDQKPKSLEDLR
VWNFDGSSTGQAPGYNSDTLLKPVAMYRDPIRRGDNILVLAACYTADGSANHFNHRDGCV
KLMEKHASQDIWFGIEQEYTMLDYYDRPFGWPKGGFPGPQGPFYCGVGTGNVFARDIVEA
HYKACLYAGINISGVNAEVMPSQWEYQVGPCRGIQMGDELWMSRFLLHRIAEDFGVKISF
HPKPILGDWNGAGCHTNVSTKDSRAEGGMKAIEQYLEKFAKRHMDHIKVYGDDNDLRLTG
KHETGTIEQFNYGIADRGASVRIPRSVAMKGCGYFEDRRPASSIDPYLVTGIITETMFEF
Download sequence
Identical sequences S9X1P1
EPY51022 XP_013024531.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]