SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPY51660 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51660
Domain Number 1 Region: 227-375
Classification Level Classification E-value
Superfamily E set domains 0.000000098
Family Arrestin/Vps26-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPY51660
Sequence length 432
Comment pep:novel supercontig:GCA_000004155.2:supercont4.3:187869:190244:-1 gene:SPOG_00085 transcript:EPY51660 description:"arrestin"
Sequence
MKIIKRNNQLFHRKNETIITCSTANYAAKEVIYDLTSSSKLKSSEVVLTFEFDSPIFFQE
SELNGLIHLAVKPKERPIGLIRIETQILGISQCKQGHPTVFYCTGKNIMDRKFTVPNELA
EHSRNTTGDYLIDIQHTQGIPVAFQMELYGQVGPGRQSTPQFNINYYIFANAIYQYGDKV
KKVRECQEINVLPRVLSSTFLLSPPLMCVSKPRTKLGLCKHNTANGITVRLPRSEWLGGE
RINANIKVENYGDYEIKYVNLSLFKRITIFRGPLGKRYQPDALSRAKKRNSIRKETWICV
QKEVINERRKNNYYNWKGIDTLGTHTMECQIRIPDREATINVGSDFQVEYILQISIGSRL
RTFNCVKMPLQILPAYALPMEREASFVDAALYDSGDNSIVLSPNSSRGFHRMSYEAHPTA
EHVSANSYVFLG
Download sequence
Identical sequences S9W0T5
EPY51660 XP_013023046.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]