SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPY53930 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY53930
Domain Number 1 Region: 189-248,275-339
Classification Level Classification E-value
Superfamily E set domains 0.0000000217
Family Arrestin/Vps26-like 0.065
Further Details:      
 
Weak hits

Sequence:  EPY53930
Domain Number - Region: 341-515
Classification Level Classification E-value
Superfamily E set domains 0.00105
Family Arrestin/Vps26-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY53930
Sequence length 668
Comment pep:novel supercontig:GCA_000004155.2:supercont4.1:1953148:1956580:1 gene:SPOG_02848 transcript:EPY53930 description:"arrestin Aly1"
Sequence
MKGELNIPALSRFGKSISASLHHQNDPSNEENDTSSQNRSTSNSGLGRRNSIFSVNASNG
FGSLSANRSNKQSSPRPPPPPLESPFTDSTAVVPNNISSAVSTPVNNRMPIKPPLTWSPS
SANLFGTSRITSIIGNNVSDIVPPVIKKALASSHGGGMSLSIVLLEPVLYLSGYDINECQ
NENPVILRGALVLRVAKPANIRGISLSFTGRSRTEWPEGIPVKGHETYEDKIIICHHWNF
YNPNIKDADAPQHGADVARLVGEHVSLPSSSAAGLRGYSVFAPGEYTYNFDLAIPNCFPE
SVEAKLGWVRYFLEATVERFGTFKSNLNGRTPVQLVRTPSPASLSSTELINISRDWDERL
HYELQVSGKSFRLGETLPITFKFLLLDKVRLYKLSLSVVETAEYWCRSRKFHRVDPKRRV
LLIERSVKHHNTDNLFSIPDEGDGISSAIFNFNVKLPTCIVKERDRLTFDTTYKYIKIRH
RLKALLVLSVENEGNPEKRKYFEINIETPIRILSCRCVKDSTLLPPYELTHRDSQVLLPC
PCRLDATQVEPAEVTPFTTQSVLASSSAATASSRKPTRPELFRIPSTNPPPFEGDICPPP
CETPPPNYDELFDALNSINIQGCETDLANDDTILNSRSRRGQVVGSNSTRTPRRHLSRTA
SRSFDLQR
Download sequence
Identical sequences S9W859
XP_013020963.1.62511 EPY53930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]