SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Agabi_varbisH97_2|192415|estExt_fgenesh2_kg.C_50152 from Agaricus bisporus var. bisporus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Agabi_varbisH97_2|192415|estExt_fgenesh2_kg.C_50152
Domain Number 1 Region: 172-391
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.13e-89
Family ATP sulfurylase catalytic domain 0.0000000153
Further Details:      
 
Domain Number 2 Region: 4-170
Classification Level Classification E-value
Superfamily PUA domain-like 9.05e-52
Family ATP sulfurylase N-terminal domain 0.00000111
Further Details:      
 
Domain Number 3 Region: 392-507,544-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-31
Family ATP sulfurylase C-terminal domain 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Agabi_varbisH97_2|192415|estExt_fgenesh2_kg.C_50152
Sequence length 575
Sequence
MANSPHGGVLKDLIARDVRIANELEEETQSLPNIILTERQLCDLELIMNGGFSPLEGFMN
EANYTSVVDNLRLVNGTLFSMPITLDVSKADIESIGIMPGSRITLRDPRDDEALAIITVD
DVYKPDQVREAIRVFGADDPAHPSVAYLRKNVKEFYVGGKVQAIRAPIHFDYVALRYTPA
ELRAHFTKLAWRRVVAFQTRNPMHRAHRELTVRAARQHRANVLIHPVVGLTKPGDVDHYT
RVRVYEAIMQKYPNGMGHLALLPLAMRMAGPREAVWHAIIRKNFGATHFIVGRDHAGPGK
NSLGKDFYGPYDAQDLVMKYRDELQIEMVPFQQMTYLPSTDEYQPVDEVPKGVQTLDISG
TELRRRLRTGAPIPDWFSYDAVVKVLRESYPPRHKQGFVLFFTGLHNSGKDQIAKALQVS
LYEQGGRSVSLLLGETVRQELSAELGYSREDRHKNLQRIAFVAAELTRAGAAVIAAPIAP
HEASREAARETILQNGGAGANVFLIHVATPLEYCERTDRKGLFAKARRGEIVGFSGVDDL
YEVPSKADITVDVSRQGVPEIVHSILLLLEAQSLL
Download sequence
Identical sequences jgi|Agabi_varbisH97_2|192415|estExt_fgenesh2_kg.C_50152 XP_006460822.1.82868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]