SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375264382|ref|YP_005021825.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375264382|ref|YP_005021825.1|
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily MtlR-like 3.66e-58
Family MtlR-like 0.0000000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375264382|ref|YP_005021825.1|
Sequence length 176
Comment mannitol repressor protein [Vibrio sp. EJY3]
Sequence
MADNINETEIIERLNGAPSVRGFFIATVDVFNESIDGLIQRIFRKDNFAVQSVVGPLLQD
SGPLGDLSVRLKLLFGLGVLPDDIYHDIEDIIKLKNQLNSDASDYEFTDPNILDPIKKLH
LVKKMGMVQLEVNEPDDDIDLEFYQLQLQRQQQIIKSGLSLAIVEICNELGKESPF
Download sequence
Identical sequences A0A1B1E9D9 H2ID92
WP_014230740.1.13071 WP_014230740.1.14200 WP_014230740.1.16983 WP_014230740.1.18931 WP_014230740.1.37005 WP_014230740.1.50333 WP_014230740.1.59672 WP_014230740.1.84506 WP_014230740.1.88247 gi|375264382|ref|YP_005021825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]