SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|22230|fgenesh1_pm.00153_#_27 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|22230|fgenesh1_pm.00153_#_27
Domain Number 1 Region: 38-360
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.81e-59
Family beta-Lactamase/D-ala carboxypeptidase 0.00000035
Further Details:      
 
Domain Number 2 Region: 468-565
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 1.75e-43
Family D-aminopeptidase, middle and C-terminal domains 0.0000931
Further Details:      
 
Domain Number 3 Region: 386-461
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.00000314
Family D-aminopeptidase, middle and C-terminal domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|22230|fgenesh1_pm.00153_#_27
Sequence length 566
Sequence
MQRKIVVGASAVGKLILAGAHIGVWLGYKYFVLVTVANIQDILETVPSRYRGPGGAVAVV
KNGELVGEHVWGYADLRNRIPMKTSTLMPICSITKQMLCLILKDLERNPTPEMAKRGNVP
QQWSAILRQLVPRELIEDTGLRLDHLYNNQSGIRDYWAMSMFWGTQPEGGFTLAGDAKKA
LGRTKSLHYQPGTQYSYCNLNFHILARVVEQVSGKALGELLAERLFSPAQMKSASLCADN
TKLPPPCVGYEGDESFGYIPAINRTQWSGDAGAVASLEDMVAYERYLDQAWADPQSLYRE
MAQDPSFEDGTPARYGYGLERMTFGQIATIGHGGAIRGFRLHRIQAPSERLSVVVMLNHQ
ADAAAVAGHILQEALGLPKQQPMISDPSPSWVGTFFDPDAQLAVEVRLGGPGQIIVTYTG
DDETLSLVDECTARSGSTTATVSVDGLSLHRIDDNRHIHAKRIEAGQQPPKGDYIGQYHC
AEVDSTFHCSGEGGMLYGSFGGFLGQGPAELMRYLGDDIWVLMCARGLDAPAPGNWTVVF
QRGDHGDITSVVFGCWLARKVTFVRQ
Download sequence
Identical sequences A0A1R3RI14
jgi|Aspca1|22230|fgenesh1_pm.00153_#_27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]