SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn043041 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn043041
Domain Number 1 Region: 109-187
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 8.72e-17
Family Frataxin-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn043041
Sequence length 188
Sequence
MASPSSKLLLLRRLSRALKPPSSSSSSMIRKSCIRYSTHLLEASNCAHRPTLSPPSRSFC
SRSPALDGGEGPATIDYRCVMFSTSLDNFYRCLVGEKTEDEKKFVRNLEDEFHNLADSTI
HDLLEKLEVILVDVTFNILKEYGDSIDINGFDIDYGNQVLTLKMGTLGTYVVNKQKPNRQ
IWMSSPVR
Download sequence
Identical sequences Achn043041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]