SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn124801 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn124801
Domain Number 1 Region: 117-151
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000667
Family Rho termination factor, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn124801
Sequence length 155
Sequence
MPFRCIPGLAKIADGPSLFASRKDFAQLNVLSIRADGNGRGEKTSTKEGNKSPTWRSHLL
QKERNAREDPSVADLKLTRPLSNFVKRSPIPIPSSQRKKLIEQKIEACSATNSEEIELQK
LEEMNVSELKELVKIRGIEGYSQLKKSELVEVLKS
Download sequence
Identical sequences Achn124801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]