SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn142381 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn142381
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 0.00000000000345
Family Type 1 signal peptidase 0.034
Further Details:      
 
Weak hits

Sequence:  Achn142381
Domain Number - Region: 409-440
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00177
Family Rho termination factor, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn142381
Sequence length 448
Sequence
MVPTIEGQGGTLLVRKLPAADPTRVFVGDVVVLKDPEKSENYLVRRLAAIEGFEMVSTDE
KEEPFVLDKDECWVLADNENLKPKEANESRIFGPVPMTDIVGRVIYYLKTAVDQGPVQNS
HFGMRKDSPVLEVELDVDEMAKGPNSYRRNPDLSRQNKQWFSRNRNRQNNERDGSENLEE
SEELSSKNGPLHSVSSAPKFQATATPGPRERGIVEMFRKVQAQLREGATLKEEKKPEESQ
GRGNESESVDSLLKLLRKHNTQPGKKSSSSSGSSRSFILDQPEPNGASEETKSTTFLNSN
NHVADEVARGPKSPPFGRPVSNFQRRSPVPQVSKFQPIPSDSVTDTWINGKRDIIHPEPE
IDELKLGIEAESSFSDGDVFGGTSEYEDSDIDVVYSDEDVEEEKPIVEEDLSAMKLPELR
ALAKSRGLKGYSKLKKSNIVELLSGGST
Download sequence
Identical sequences Achn142381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]