SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn007421 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn007421
Domain Number 1 Region: 410-542
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.1e-16
Family Anti-sigma factor antagonist SpoIIaa 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn007421
Sequence length 608
Sequence
MEITYASSSSRDLAAAAAAADHSSAADQTMPKTTGRPVKVIPLQHPTEETSSSSRSSDLP
LVSRWRSKLNRMTLTEWIELFLPCFLWLRTYKWREYLQLDLMAGITVGIMLVPQSDSGFI
PIFVYAVFGSSRQLAIGPVALVSLLVSNVLGSIVDSSDELYTELAILLALMVGILECIMG
LLRLGWLIRFISHSVISGFTTASAIVIALSQAKYFLGYDIVRSSEIIPLIKSIISGADEG
KSRKYLRVLRAAGPLTAVVLGTAFVKIFQPSSISLESVGIAKALAAKNGYELDSNQELFG
LGVANIFGSFFSAYPTTGSFSRSAVNHESGAKTGLSGLVMGIIMGCALLFLTRLFEYIPQ
CALAAIVISAVIGLVGVSLAFVIHESANPHVAVLGRLPGTTVYRNVLQYPEAYAYNGIVI
VRIDAPIYFANTSYIKDRYRIIWCSFVRLREFEFEVDESTKRGPEVERVYFVIIELAPVT
YIDSSAVQALKELYQEYQSRDIQMAIANPNREVLLTLARSNVVELIGKEWFFVRVHDAVQ
VCLQHVQSLHETPKTTEPLSDDTPSFFKRLLKHRAEELSVAELESCDRHSSISNVTDPQL
EPLLPRRS
Download sequence
Identical sequences Achn007421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]