SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn024331 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn024331
Domain Number 1 Region: 125-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-37
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1567-1670
Classification Level Classification E-value
Superfamily BRCT domain 6.69e-18
Family 53BP1 0.043
Further Details:      
 
Domain Number 3 Region: 612-677
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000883
Family PB1 domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn024331
Sequence length 1800
Sequence
MASRNDVQVQKVETINDVSRCNNQGEKDDLYTQLWHACAGPLVHVPRVGDKVFYFPQGHM
EQVEAYTNKDGEVEMPVYNLPSRILCKVVYVQLKAEAQTDEVFAHITLLPEQEGPSLEHG
TSQSVPQKVNTCSFSKRLTPSDTSTHGGFSVPKRYADECFPSLDMSQDPPAQELVAKDLH
GSEWRFRHIYRGQPKRHLLTSGWSAFVGAKKVVAGDACLFLRGENGELYIGVRRASKPDT
IMSTSVISGHSMQHGILASAFHAISTGTMFTVYYRPWTSPAEFIIPRDQYTKSAENDYSV
GTRFRMPFESEECPENKYCRFAGTVVGIDNIDPIRWAGSEWRCLKVQWDSPPDTIVLPER
VSPWNIEPMLKKKKCNSLFPHRKRARPQDPSTPGFPVVVQDGFLKGSVEYTPKRLSWVLQ
GQEIRGTGACAFGASTQPNSDWHHQLVGSENQLPFQMHDPFSRGSTISVPGGIPPNPRLT
NYWPSPFTLIGDCVEASKSVSFPKVNPTGSVSQDWKASEEKKDEVKSPLEKPIGNDKCML
FGVNIFSSPPELPSPQVVSSTELHSLCPAPPATSHSSISEHVQVSEPSKSISGNLSEKQC
KNCCSNANRSCTKVLKYGTALGRSVDLTRFDDYGKLIRELDQMFDFKGTLIDKSSGWYVT
YTDGEGDMMLTGDYPWPSSSEETPLQNVDGDAEVQDIPDYVKDTESQMVDDYEEEVVLDS
DDELAHKTEMVSIKELSSGAPQRTAGGDVLDTSCVQYKDFVLGSTASARKQCHIGYVRRG
AGSASHRPNPIHSDACSQKQLVIKDNETPRPEDQFSGEKKVSEAVKDRDNLESNVNIGKF
KDDPRSGDVLGKISTRNTFGGCKLSETKCDSSGCENDCTLLISEHDTEELRHNESQEPGE
LSQANALDVVDHYLSFNNMNLSEESAPTKTSRQKSPPILCAKGPQIMARRARFRMPGTFE
WVDNQIDDEEGDLLIKRKDLNLHGEGPEPASVTRHLSAIDLNVQRRRNLDIQHKEKFQGE
DMGVDFSNSSFIGLNSEEVDQVSEMKFAEEIDEQLNSESGQELEARDVEPDIFDVGFDTQ
MAAEAMEALFYAPLPNSNLDSSHQYPDKMVEDSSIGAAEKCSFSTRDHSNSRVAARKLKQ
SKRPSKKLSGKTFSSSRKNKKSQNELNPEIPKANKMKRGKSLAENHITFEKLTNAQEHSR
QSSFKLNGQGKEDKILGRYNIKKGTKNLISSVAVKHNSIEEGPSEGKHRTFAPITHETRS
SPSVCPLKGIEDPIKSSGKRMSDVMEASDLKKRNNNSQNDDMHQVPIVRRKRLKIGLHIS
EEAAGVKVSQQAEKELGVAPPGSHLKLDAWSYPKGKRKNRNLPHHLKGLSDICLPSTLAN
GEKGNGYAIESHKKSPGNSERSCFNVYVRRKPRSSAYACQVRSSLVKNCDESLLRQSSDN
RSSADVCSGSFVMNRKMTALDPDRVQAYRKSEEPDHADFTSPTDGVNGNIKLDILSRRNA
KASFPKCPSPVNNTKGLDLVPAIHKDDQNCKQMHNRNLFRFPRMKELISLGFSGSLTEIT
SKDLRRRRDMAHVRVVFSQNLEDDIIKQQKKILARLGSSIASCCSDATHFIADRFVRTKN
MLEAIALGKPVVTHLWIDSCGQASCYIDEKNCILRDAKKEKEIGFSMPVSLAQARQNPLL
KQGRRVFVTPNVKPGKELIESLVKAAHGQAVDRIQEAVMKNKIFPGDVLIISSEQDYALC
TPFLDKGAAVYSSELLLNGIIIQKLEFERHQLFEHHLKGNCSRTGPKKHGDWSLPVPICK
Download sequence
Identical sequences Achn024331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]