SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn034241 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn034241
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000068
Family B3 DNA binding domain 0.0093
Further Details:      
 
Domain Number 2 Region: 534-609
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000275
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn034241
Sequence length 661
Sequence
MHTGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSSVLS
SDSMHIGLFAAAAHAAATNSCFTIFFNPRASPSEFVIPLSKYVKAVYHTRVSVGMRFRML
FETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT
FPMYPSLFPLRLKRPWYPGASSFQDGREAAVNGMAWLRGETGEQGLHSLNFQNVGMLPWT
QQRVDTGFVRNDINQQYQPMLAAGLQNIGGGDSLKQQFLQLQQPFQYPQLSGSQNLVLQQ
QQQQQQHQVIHPSISSHILQAQTQMLPEDLPRHMQQHVNNQPEEQPQQHTYQDAFLIQSD
QLQQRQQSNIPSPSFSKTDFADSNAKFSTSVAPSIQNMLGSLCADGSGNLFDFSRTGQSM
LGEPSQQSWVSKFTHSQGNTSANSVSLPPYPGKDTAVERENLSLDGQNHALFGANLDSGL
LLPTTLSSIGTSVNANVSSMPSGVSGFQSSLYGCMQDSSELLHSAVQVDPPTPTRTFVKV
YKVGSVGRSLDITRFNSYHELREELGQMYGIQGLLENPMRSGWQLVFVDRENDVLLLGDD
PWEAFVNNVWYIKILSPEDVQKLGKQEVESFCHNDGERMNTSGNDARDFVSSLPSVGSLD
Y
Download sequence
Identical sequences Achn034241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]