SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn060451 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn060451
Domain Number 1 Region: 149-274
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-43
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 625-703
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000368
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn060451
Sequence length 752
Sequence
MRVAESGFFFMEIDLNTCDNGGCLSSSNSSSCSSNSSSSPAAASIDKELWSACAGPLTSL
PKKGNVVVYFPQGHLEQTGSSAPFPHLEVANFDLQPQIICKVMDVHLLANKENDEVYTQL
TLLPRPELEVINLEGKDHEDVGLEEEGGLTPTNTLHMFCKTLTASDTSTHGGFSVPRRAA
EDCFPPLDYKLQRPSQELVARDLHGVEWKFKHIYRGQPRRHLLTTGWSIFVSQKNLVSGD
AVLFLRGEGGELRLGIRRAVRPRNGLPDSILANQNYQNILSHLATAVSTKSTFRVFYSPR
CSGVVTGIRDSDPYRWPNSKWRCLMVRWDEDSTSDHQEQVSPWEIDPSVSLSPLSIQGSP
RLKKLQEDLPATPPNNPIAGVGGFLDFEESLRSSKVLQGQENAGLLSPLYGRDKLNRPLD
FEMQSFALQSLTSNGKEKVNFSEFMKSQQPTTYTGFAESSRFPKVLQGQEICSLRSLTGN
SDFNLGAWSRPDLGCNFLNMYQRPKPNFYPLGSEGVRNVYFPCNDIHKAAQDPVILSHVT
NFQRENITFKGSSVQIGFTRDEVTKQNLPKETPQGNIAGPPTSKASFKNVNDEISNGTMA
GFKLFGCTLTGETPVLNSQSSNKRSCTKVHKQGNLVGRAIDLSRLNSYEDLLIELERLFS
MEGLLRDPDMGWRILYTDDENDMMVVGDDPWPEFCGMVSKIHIYTQEEVEKMTIGMISDD
TQSCLEEAPAIMGVSKSSSVGQPDSPPTLIQM
Download sequence
Identical sequences Achn060451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]