SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn060941 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn060941
Domain Number 1 Region: 255-362
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000205
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 42-180
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000732
Family BTB/POZ domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn060941
Sequence length 582
Sequence
MDTRTAFSDSNDLSASSTVSCAANTESFSPEALTPEIASLRRLSDNLQSIFDSSSPDSSF
ADARIAFAGGREVSVHRCVLSARSPFFKDAFGGKDRGVKLELKDLAKEFDVSFDALVAVL
GYLYSGRVGSLPEGVCVCVDDDCSHAACRPAVDFMVEVLYAAFAFQISELVALYQRRLLD
ILGKIAPDDIVLVLSVANICGNACETLRTRCIENIVRSDVDMITLDKALPQHLVKQIVDA
RIEVGLHGLENGFPDKHVKRIHRALDSDDVELVRMLLKEGHTSLDDACAIHYAVAYCDAK
TTMELLDLALSDVNHRNPRGYTVLHVAAMRKEPKIIVSLLTKGARPGDLTLDGRKALQIS
KRLTRAVEYHKSMEEGKASPKDRLCIEILEQAERRDPLPGEASVSLALAGDDLRMKLLYL
ENRVGLAKLLFPMEAKVAMDIAQVDGTSEFPLAVINSRNLSGTQSTTMDLNDAPFKIKEE
HLNRHRALSRTVELGKRFFPRCSEVLNKIMDADDLSELAYLENENDEERQLKKQRYTELQ
EVLSKAFNEDKEEFNRSKNLSSSSSSTSMGLGRPNGKLTFKK
Download sequence
Identical sequences Achn060941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]