SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn069381 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn069381
Domain Number 1 Region: 193-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000209
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 67-159
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000419
Family B3 DNA binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn069381
Sequence length 394
Sequence
MCSLMIGPRGAIQEQEEDKASLDYASMEVHAFSSDPTESDTDLEADAKTGDPSSSPTKVN
EFNFRQFLFEIQLTPTDVEKGGLFIPVETALDFFPPLTASLQRIYYEKIKISSPTETRAW
SMAITYDPEESLFLINSRKWQQFAHHHGFKAGDIIRFFKPFPRAENTHFLIEHVKKADEE
GTSSTVVVPEFEEENFLFQKQLTLYEVRNLIKRPLPLPKEEVKKHFAAVRIPVSSHRMER
LYFTDAWNKEWCWKFMFLSGKHMVMDGWEGFVNEHKVDAGDAIRFYKFTENRKLHPERHF
LIQHVKKANVQVVNPPTAEHVAGTSTNPTAGQPGTGARNEENRGVENTNARIEGGQGGGS
NQRCGSLGGGNKRGGGQSGGRREKKSGFRNCCMA
Download sequence
Identical sequences Achn069381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]