SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn069911 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn069911
Domain Number 1 Region: 487-593
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000628
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn069911
Sequence length 619
Sequence
MVRGRPKLGANIHLMAGGKYFADINLRERIVIFSTSGRTPPPNPNPNPNLHLQSPPKKSS
TRHPPASHPSPPFPTVLRRQSPTPPGPHGDSSFADPYDSRSVKILKKFTMKDNSEANNNN
DNSNGVGNNNLVVALEEPKENYWDLVRMALSTEGIFILDDETSSFLNSLKTQFLGRKWIN
GCVSFKNAIKNGSVPEMPELGKPIDGFTPPKLPPVHALEGLIGECGVPFEQQLTETDMNK
HRARLLIAQELDEKFVMPFMSEEERRSLKCGQEIQVTACEYINKIFSNYPPHTQARIDLL
NDVHSSIRFHIGQSPKKKSSTRQPPASHPSPPFPTVLRRQSATPPGPHGDSSFADPCDSR
SVKILKKFTMKDNSEATNDNSNGVGNNNLVVALEEPKEKYLHLVMTALSTERYIILNDET
SSFLNSLKTQLLGRKWINGCESFKKAIKNGSVPEMPELGKPIDGFTPPKLPPVHALEGLI
GECGVPFEKQLTETDMNKHQARLSIAQELVEKFVMPLMSEEERRSLKCGQEIQVTAYGSN
GIEYPMKFKFWASKMHVLTSGWNEFRIDNEFKSLHDWVTIWVFRHKRTRKLCFGMIARRF
PTNQLIRFQKKKKGEKMNK
Download sequence
Identical sequences Achn069911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]