SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn100331 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn100331
Domain Number 1 Region: 308-459,662-780,830-876
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.71e-38
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 2 Region: 806-946
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000337
Family Quinohemoprotein amine dehydrogenase B chain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn100331
Sequence length 975
Sequence
MRYFEDAVTNGEWDDVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKLDHAKAVEIL
VKDLKVFSTFNEDLFKEITFLLTLGNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLF
RDKLQFPTLKNSRLRTLINQSLNWQHQLCKNPKPNPDIKTLFVDHTCGQPNGARAPSPVT
NPLMAMPKVGGFPPLGAHGPFQPATAPAPAPAPLGTSLGSWMVNPSSVPHQVVSAGPICI
SAPNNAVGTNIGDIAVWDVGSRERQVFRNFKVWDIGRCTMTLQASLVSVAYSKHIVHIYA
YHGGADIRNHLEVWDAVTGSKQYTCEGHEAPVYSVCPHTKENIQFIFSTGIDGKIKAWLY
DNAGSRVDYDAPGHSCTTMAYSADGTRLFSCGTTKEGESHIVEWNESEGAVKRIYHGLGK
RSVGVVQFDTTKNRFLAAGDEFVIKFWDMDNTNLLTTTDAEGGLPASPCIRFIKEGILLA
VSTSENGVKILANGDGVRLMHSLESRALDPSRISSGTAAKTPIMGTFGASSSAAGTNVGV
AGGNAPVTAMVASNGDTRSLPDVKPRITDELEKPKIWKMTEINEPSQLRSLRLPDNLLSV
RIIRLIYTNSGGSVLALAYNAVHKLWKWQRNERNLMGKATTSVPPQLWQPSSGILMTNDI
SDTKLEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFIAFHPQDN
NIIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSNVLNVLVSSGADAQLCVWSTD
GWEKQGSKFLQIPSGRTPAPLAQTRVQFHQDQVHLLVVHETQIAIHEAPKLQCVKQWVPQ
ESCGSVTDATYSCDSQSIYASFEDGSVSVLTAGTLRLKCRISPTAYLPSSPSSRVHPLVV
TAHPSEPNQFALGLTDGGVHVLEPLETEGRWGTTPPLENGAGSSVAPVAASSDQPSRGLT
LLEATPGGRPSRDPS
Download sequence
Identical sequences Achn100331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]