SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn107011 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn107011
Domain Number 1 Region: 186-285
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.16e-30
Family B3 DNA binding domain 0.00000807
Further Details:      
 
Domain Number 2 Region: 65-122
Classification Level Classification E-value
Superfamily DNA-binding domain 4.32e-16
Family GCC-box binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn107011
Sequence length 348
Sequence
MSVEAAAGLRGDEHTEKTLGPRLFRHQEMDGRSTDESTTSTDSLSIPAPLEGGVEAESSR
KLTSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEAEAARAYDVAAHRFRGRDSITNF
TSSSERDSDSEKGDDLEAVFLASRTKAEIVDMLRKHTYNDELDQSRNEHESRGPTNDRAM
EATEQLFEKAVTPSDVGKLNRLVIPKQHAERHFPLSVSKGLLLNLKDAIGKVWRFRYSYW
NSSQSYVLTKGWSRFVKEKNLKAGDVVRFSRSINHDKQLFIDWKTRGGSGVLNPVRPVQM
VRLFGVDIFKVPVSGGVDSSGSCGGKRMREREFLGLECGKKPTVIGAL
Download sequence
Identical sequences Achn107011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]