SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn116231 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn116231
Domain Number 1 Region: 941-1243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-77
Family Extended AAA-ATPase domain 0.000000026
Further Details:      
 
Domain Number 2 Region: 1283-1599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.83e-77
Family Extended AAA-ATPase domain 0.0000000227
Further Details:      
 
Domain Number 3 Region: 134-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-40
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 4 Region: 787-920
Classification Level Classification E-value
Superfamily Double Clp-N motif 2.9e-30
Family Double Clp-N motif 0.0015
Further Details:      
 
Domain Number 5 Region: 567-644
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000687
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn116231
Sequence length 1633
Sequence
MASSDVSFKGNTKGESFSSVSGAGKVDAETALYTELWRACAGPLVTVPREGERVFYFPQG
HIEQVEASTNQVSDQEMPVYNLPSKVLCRVINVQLKAEPDTDEVFAQVTLHPLKEDENEV
GKEPVPPPLPRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPTQELVAK
DLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMR
QQSNVPSSVISSHSMHLGVLATAWHAYTTGTIFTVYYKPRTSPAEFIVPFDQFMESFKSN
YSIGMRFKMRFEGEEVPEQRFTGTIVGIDDADPQRWTESKWRCLKVRWDETSMIPRPERV
SPWKIEPALTPPALNPLPVPRSKRHRSNMVPSSPDSSVLTREGSSKVTIDPLPASGYSRV
LQGQEFSTLRSPLAESNKSESSEKPVVWPPTREDEKIDVFSVSQRYGPLVKPQSTFTNLF
SGNCNPVAAESAQSHKNTYLPEAHSNLVPHSQQSWAFETDQRSEQRDGVKVSNHTIPSSE
QENPSPTSQPTIRDRQGKVQGGSTRSCTKVHKQGIALGRSVDLTKFNGYEELIDELDQLF
EFNGELKAHNKNWLIVYTDDEGDMMLVGDDPWMEFCDIVRKISIYTREEVQRMNPGALIS
KREENSLVGEGTNDKEVKNSTSPLAPSPKKYHLEEVMARALVQSTIFPSSIAVERHDRLK
GSGRTKRTVKMMCALQSSPLRSFSGLRGSNALDSVVRSGHGFHSKAATATSVRRKKASRF
VPKAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINL
KDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSEHLLLGLLREG
EGVAARVLENLGADPNNIRTQAKSTEAVGAGVGVGSSGNKMPTLEEYGTNLTKLAEEGKL
DPVVGRQPQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQQIASGDVPETIEGKKV
ITLDMGLLVAGTKYRGEFEERLKKLMEEVKQSDEIILFIDEVHTLIGAGAAEGAIDAANI
LKPALARGELQCIGATTLDEYRKHIEKDPALERRFQPVTVPEPTVDETIQILKGLRERYE
IHHKLRYTDEALVAAAKLSHQYISDRFLPDKAIDLIDEAGARVRLRHAQVVESHLCSSQL
PEEARELEKELKQITKEKNEAVRGQDFEKAGELRDREINLRAQITAFLDKSKEMSKAETE
AGDGGPVVTEADVQHIVCSWTGIPVEKVSADESDRLLKMEETLHKRIIGQNEAVEAISRA
IRRARVGLKNPNRPIASFIFCGPTGVGKSELAKAIAAYYFGSEESMIRLDMSEFMERHTI
SKLIGSPPGYVGYTEGGQLTEAVRRRPYTVILFDEIEKAHPDVFNLMLQILEDGRLTDGK
GRTVDFKNTLLIMTSNVGGDVVSGKSRDILSGLGFKQPEKSTDYGDIKNQVVEKLKTYFR
PEFLNRLDDVIVFRQLEWKEVETIASLMLKEVCDRLKTKEIELQVTEYFVDKVVREGYSR
SYGARPLRRAIMRLLEDSMAEKMLTREFKEGDSVVADIDPEDGKVIVYHRRVPRPLSKPP
KLTGRRIPAPTAS
Download sequence
Identical sequences Achn116231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]