SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn127421 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn127421
Domain Number 1 Region: 532-605
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000147
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn127421
Sequence length 651
Sequence
MKGEEYQEIWLERQEQEQDLLDVYEASIFYNDSTGLPDFPRMSSSSSAPAPAKPIASSSP
SASSSSSASWAMLKSDAEEYGEKKSISNNNDNRLTPPVASLSAATSMEVLQPPQSYGDAD
CMDMMETFGSMELIESNEIWDPSSIFQTEQPPQESQHYPQNGDSFMFEEINIEMRERERE
QNKPPTDELGVLFFEWLKSNKESISAEDMRSIKLRRATVECASKRLGSTKDGLKQLLKLI
LEWVEQYQLQKKQRLAELNPPFPPPYLEPPLQNPNPNSLPPNINNPCCMPSTWVPLPRPP
YYPTTAVMAATPGLYGGDPYGSSVPVPVPNYAQSMEYNMLDSSQTWPPSQYAMSAQYNQF
SENNNNNNNRSNNNSIPMVTPLSPAFVGYGNQYQYYQRSGNKLVKLGSSATKEARKKRMA
RQRRFLSHHHHHQHHHHHHNHNQQNQHQNQNPDRQHHRLGGDQNCLNVGQASSANWDYWP
NAAALASSNVAVVAVEALQQPPLVQSQNYQQQQPQWRVSSDSKVSSDWQRQKEAEIHLPE
LEARDGIPIAMEDIGTSQVWNMRYWFWPNNKSRMYLLENTGDFVQANGLQEGDFIVMYSD
VKCGKYLIRGVKVRQPRPKSEAKKPSKSHKNTHTASPSAASGSSPPPSHRE
Download sequence
Identical sequences Achn127421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]