SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn128001 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn128001
Domain Number 1 Region: 241-357
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000122
Family B3 DNA binding domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn128001
Sequence length 376
Sequence
MPLIQSTHFIIPNLQQKSVESALKTSLMGSLNFGGSIRSAAALKSKQQKKMMIEDDAGQY
LSREDFPGNQRKCFFSTFDYILWIAAVDSRDILDKPLNHHPSLSDLLQITIPKSKRSPRN
NVTSPVFVSAPNINQRAGPKRVRFDSDAEKKMPKRERSVGLNITFKALVDHSTASNMVNK
NNQRVGSKRGRCDIDAEKDRPKHKKKKKIMITYVPPNPTPNLPANFKERIQGLNGSDLVL
VIQKPLFATDVSKNHYRLSMPLNQIKNQFLSWNEKDALMNQNGVGVPEMEVFLIEPSCQK
ETKMNLKIWAMHKGPKCKAKVSYMYSLGKHWNEVVSGNGLEEGMTVQVWAFRVEGNLGFA
LVRVEEPAVPQEGNGA
Download sequence
Identical sequences Achn128001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]