SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn129501 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn129501
Domain Number 1 Region: 118-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000432
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 239-316
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000392
Family B3 DNA binding domain 0.0054
Further Details:      
 
Weak hits

Sequence:  Achn129501
Domain Number - Region: 30-77
Classification Level Classification E-value
Superfamily Phage tail protein-like 0.0194
Family STM4215-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn129501
Sequence length 369
Sequence
MATFHQVNRFLFQLPFNTNDKVLQRLLIPLEHVRKLFLGIYVPRAGPFLAVGEAFYLEFT
DPLNRYQTEIATETESLDNMIVSGEDSKSGNQTEGSDKMSVSGEESKPGDSSGESEKDNM
LIEKHLTRRDVEDNLFFRFDLVSKFFPPPPVGRIPNAQLLLSSETVDDNDRFVEKHWDVT
LTYSCADSEFVISTGWQKFVSDNMLEARDFIQFYLPDPRTHDKHYDIEVVRSHELDLKEN
FVFELQLKPHDISSERLVLGMGHVRILLPEINTTLELRFTDSQKKDWCMKTKFDYKRDGY
LVTNGWKEFLNERNLDTMHKIKLCKPALPLRKYHFLISHEKTENDGGSGTDPFQSVDDDG
GSSSNIGSN
Download sequence
Identical sequences Achn129501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]