SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn131801 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn131801
Domain Number 1 Region: 500-599
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-24
Family B3 DNA binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 276-378
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.55e-23
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 3 Region: 50-132
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-20
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn131801
Sequence length 629
Sequence
MESSRETVSMTVLVEVENELVVERTMVAPVIGLVVVEERELPEEERRHEIIPSKFMKYLE
GKASGTVSLVGPSGNTWHVELIQHNGNLFFHDGWPAFVQDHTIERGDALVFRYDGDLHFT
VQVFDQSLCEKEAAFSAACTQDHGNSGKLLGWKRERVYGASSLDDIVQGVPKKARGSHAY
SGCMINHQEEGWQPDEVVSVSETCQTAIYAHETRNCCSPSMDAFSFALPLQLKVPDDNSG
AIIENRNGKESELGSSAGDGRLMLSASEAEGLARTFTSSYPNFIKTMKRFNVSGSYTLNI
PYQFSMAHLPKCKVRIVLRNLKGGSWTVNSIPTMKVNISHTLCGGWMAFVRDNNINMGDV
CIFELVGKCELRVYILRVGKEGLECQNGEAAVNGIGNGLGAASHKNSERLPKKKRSNARN
VHLQLITKGGKNKEAGGNRDKANGGPSKNSAFSSLVKACDGKLGISNKIILEEKSDSYTK
ICMSMKSAPEEKMVAQSFVSSFPHFVRVMKKFNISGSFTLKIPYQFSMAHLPDFKTEIIL
HNLRGQCWTVNSVPSTRVQTLHTFCGGWMAFVRDNDIQMGDICIFELIGQCEMRVHISGV
GKNGLDYHSGKVASNELTLATSGGNRPLL
Download sequence
Identical sequences Achn131801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]