SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn132881 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn132881
Domain Number 1 Region: 617-761
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000654
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number 2 Region: 758-947
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000719
Family Tropomyosin 0.00073
Further Details:      
 
Weak hits

Sequence:  Achn132881
Domain Number - Region: 949-1082
Classification Level Classification E-value
Superfamily Tropomyosin 0.000412
Family Tropomyosin 0.0054
Further Details:      
 
Domain Number - Region: 227-421
Classification Level Classification E-value
Superfamily Tropomyosin 0.0111
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 429-604
Classification Level Classification E-value
Superfamily Tropomyosin 0.0327
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn132881
Sequence length 1362
Sequence
MGQSLSKIRTQMKFLLVKRTNISYKIPKKFFDIFRKQMINHLKSIKCHLLANSPFLIFTT
LLTFCMYLLYSQLILVYDIEKGVPALTPPVGTLCFLTLSWFTWIPTSPIHLLGLYVHVLP
SSPPLYDLPIDREPSMEEQLQTSPEIPVMKVVEKTNSNADSIEITDSDSIPIQKEAKKEE
EETALEGEFIKVEKEPLDAKDDSNYVATPPAEDEKPSVIERSSSNSTASRELLETQEKVK
ELEQELERVAGALKHSETVNTELKDEVLLTKAKLDESGKKHEELELSHKKLQEQTVEAEE
RYNQQLNALQEALQAQDVKHKELVNVKESFDSLSLELESSRKKMQELEQELQSSEGEARK
FEELHKESGSHADSETKKALEFERLLEMAKLSAKEMEDQMASFQEELKGLYDKIAENQKV
EEILKSTAAELSTVQGELELSKSQVLEMEQKLASKDALLHDLTQELQLLKASEAQVKEDI
SALENLLLSTKETHQVKVSELEEIKSKLQEEMSSKELLEVRLRNQESQVSTIQEELSKVA
KEKEALEAAVADLTANAAQMKELCNDLEAKLQVSDENFCKADSLLSQALANSVELDQKLK
SLEELHHESGYAAATAQQKNLELEDILQASHAAATEAKSQLRELETRFIAAEQRNIELEQ
QLNLVELKCNDADKELREFAEKISHLSAALKEVEEEKKQLSGQIQDYAEKITQVESALNQ
SSSRNSELELELKDVREKCAEHEGRANTTHQRSLELEDLIQMSHSKAEGAGKKASELELL
LETEKYRIQELEEQTSALEKKCGDAEAESKKHSNKISELEMELEAFQSKASSLEAALQSA
NGKETELTDCLNVTTGEKKNLEDALRNSNEKLSETETLLEVLRNELNLTQQKLESIENDL
KAAGLKESEVMEKLKAAEEQLEHQGRVLEEATAKSSELESLHESLTRDSELKLQEAHVNF
TNRDSEAKSLGEKLQLLEARVKVYEEQIAEEAERKILETEDKAAQFYSENELLVETNTQL
KGKVNELQESLNSAFSEKEATSQQLACHMNTITELADKHSKASELHLAAEARISVAEREL
QDAFHKFSQRDLEAEDLIVKQNALQSQIKTYEEQAHEAAGVTEAQKIELEQTVLKLKGLE
GIIEELQNKLGQYEKEKEGLAESNSKLSQELTACESKLSDLQEKNTATVTEKDKALEQLC
SSKKLIEDLTEQLTLEGQKLQAQKEADSQKDAEREAALKRSIEDLEAKNEVVVLLEKQVK
ELEQKLQLADTKSKEKDGGATTTETKDGVEVKSRDIGLTFSTPTKRKSKKRLEAASAQAP
SSSSETHTQTTTKDSPVTTLKFTLGVALVSVIIGIILGKRYY
Download sequence
Identical sequences Achn132881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]