SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn146211 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn146211
Domain Number 1 Region: 116-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000196
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn146211
Sequence length 250
Sequence
MEEDSEANNNNNNGVGNNHPEETQEELREKNFAALLLVTMKYLIVDEQTSISLEALKTEA
HCQHWMKGCESFKTAIKNGLDPALPELGNPIDGLTPPKLPPIKVLEGLIGECGVPFEKQL
TDTDVNKGQGRLSIAKELVEKFVKPLMGEEERRSLEHSQETQVDVYGSKGIRYPMKFKIW
SSKTNVLTSGWNEFRGDNEFKALNDWVTLWVFRHKETEKLCFVMIARTFPTGKLVTKRSQ
KKRKAEELNK
Download sequence
Identical sequences Achn146211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]