SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn176311 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn176311
Domain Number 1 Region: 48-188
Classification Level Classification E-value
Superfamily POZ domain 5.76e-16
Family BTB/POZ domain 0.023
Further Details:      
 
Domain Number 2 Region: 251-371
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000218
Family Ankyrin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn176311
Sequence length 586
Sequence
MENGNELSSSLSFASSYLSNASTCPNVSAASAGSEPVANVGLMSLSKLSANLETLLEDPE
YDYSDVEIVVENRAVGVHRGILASRSPFFHELFKKADHSSVKEGKPRYLMSELVPYGWVG
FEAFGVVLNYMYTGQLKPSPPEVSTCVHDACVHDACGPSINYALQLMYASATFQMKELVM
LVQRRLLNFVDKALVEDLIPILMAASHYQLNQLLPHCVESVARSDLDNVCLEKELPREVI
NDIKSIRLKSLQEACAMEVEPMNEKRIGRILKALDSDDVELLKLLLQESDITLDDVNALH
YAVAYCDPKVVGEVLNLGAVNLNIRNSRGYTVLHVAARRKDPSVIVGLLAKGACISDTTL
DGQTAVTICRRLTRPKDYNEKTKQGDVSNKDRLCIDVLEREMRRKPMADNIFISSMVVAD
DLHNLLIYFENRVAFARRLFPAEARLAMEVAHADSTSEFVGFSITKGSSGDFRAVDLNEI
PSEQVKRLQSRLEALQKTVEAGRRFFPNCSEVLDNFLDDDMPDAFFLEKGTTEERRIKKM
RFMELKEEVMKAFDKDQAQNNRAGLSSSSSSSSSPKGILNQKVRRR
Download sequence
Identical sequences Achn176311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]