SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn200831 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn200831
Domain Number 1 Region: 17-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.63e-21
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 292-372
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000169
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn200831
Sequence length 386
Sequence
MSDGLWSAFEFEVSVSATIRIPVKFSSKHGKNLGKLVFLKVPSGATWTVELANSNGEVWL
CNGWKEFSEYYSICFGHFLVFRYEGNSNFHVLIFDTTASEIEYPFHGEQSNMNLNGNLRE
PETDVSIEILDEFPICRMRKTTSNRADNEKDVSVEISEDPPTCRNRRETKLVPDLTSCEM
MRTKVTCKLHNNCNLQEFSPDIQSRRIQTRGSKHANPKMDVKSHLKQATKTSTDRIFIAF
QRARAFTSENPVFVVYMRPSYISTNYCLVSYQQNSLGSIIAGILRRKIFVLQNIPMDFAK
KYLNGEQNSKITLRISEGRTWTVKCYSTTTSGKCTLSWSSFARDNNLKVGDVCAFELDTG
IELSLKVTLFRAGEYQNDDRKDKLVI
Download sequence
Identical sequences Achn200831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]