SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn209911 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn209911
Domain Number 1 Region: 56-197
Classification Level Classification E-value
Superfamily POZ domain 3.24e-18
Family BTB/POZ domain 0.016
Further Details:      
 
Domain Number 2 Region: 269-383
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000161
Family Ankyrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn209911
Sequence length 605
Sequence
MVCRLVVQVMENGNELSSSLSFASSYLSNASTCHNVSAASAGSEPVANVGLMSLSKLSAS
LETLLEDPEYDYCDVEIVVENRAVGVHRCILAARSPFFHELFKKADHSCVKEGKPRYLMS
ELVPYGWVGFEAFGVVLNYMYTGQLKPSPSEVSTCVHDTCAHDACGPSINYALQLMYASA
TFQMKELVMLVQRRLLNFVEKALVEDVIPILMAAFHCQLNQLLLHCVERVARSDLDNVCL
EKELPCEVLSDIKSIRMKSPQDINACDMEVESMNEKRIGRILKALDSDDVELLKLLLLES
DITLDDANALHYAAAYCDPKVVGEVLNLGTVNLNIRNARGYTVLHVAARRKDPSVIMGLL
GKGACISDTTLDGQTAVTICRRLTRPKDYNVKTKQGDISNKDRLCIDVLEREMRRKPMAD
NIFISSMVVADDLHNRLIYFENRVAFARRLFPAEARLAMEVSHADSTSEFVGFSASKGSS
GNFRAVDLNEIPSEQVKRLQSRLEALQKTDIVFILMTVEAGRRFFPNCSEVLDNFLDDDM
PDAFFLEKGTPEERRIKKMRFMELKEEVMKAFDKDRAQNNRTGLSSSSSSSSSPKGILNQ
KVRKR
Download sequence
Identical sequences Achn209911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]