SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn222421 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn222421
Domain Number 1 Region: 88-179
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000889
Family B3 DNA binding domain 0.02
Further Details:      
 
Domain Number 2 Region: 225-330
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000451
Family B3 DNA binding domain 0.0047
Further Details:      
 
Weak hits

Sequence:  Achn222421
Domain Number - Region: 31-100
Classification Level Classification E-value
Superfamily Ribosomal protein L4 0.0589
Family Ribosomal protein L4 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn222421
Sequence length 344
Sequence
MSESRDIDTGQEDKKGKRKFSDLQQQQETETGTGKQGHTKTNPPISDNEKNKEKALHIFL
GITYFKGELLISDDTMVTSSSTKLIEFKPENFRFEKELTANDVEHGIISFPYSTISDYFP
PVAGKPSELQIEVSDPPLDTEWQMTVKYDAAQRKFLITSGWEDFWNAHDFLGSAMIYFYI
PLPRLHARHYLIEYVRLQDRDIENTTESDSDDYAYANNDILGRVMVFELKVNRIDFKDGR
LVLPYEEARENFQEIEIPPETHEMERICFTDAWVRNWSMEVMFKNELDAYLVQDGGKEFV
DYLNLKAADVIKFYEPDNAWDPMRHFLVDCVKSNSHIPGSSSGS
Download sequence
Identical sequences Achn222421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]