SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn232401 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn232401
Domain Number 1 Region: 283-385
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-24
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number 2 Region: 3-95
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-21
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn232401
Sequence length 412
Sequence
MPPIFYRMIVSSVIHDKKLRIPGKFVKKLGNELPAVATLTTPNGCVWQVGLKKMDDKVWF
TNGWHEFVKHQSICVGYLLFFTYVGNSNFVVNVYDLGTAEINYQCHAMGSSEGWGCGNRC
QVLYKKEAEDDDKVEILENKVLDENVDQQKLGEGCNASYVQYKGRNFNGIELKSSRYAAN
GGNLRVGSVLSVERSTRDVGIQCGNIELKTSAYETRLHYLSQIPKISRKRNRGIGDESRV
SAKHKSESPAPGSETSCGTFLRRWRVVKPEEKERVLNESKMFQSQNPFCRVIMRHSYVYK
GIGLHMPSSFAEKYLGGVLGFIALQVPNGGKWPVRCMWSNGSAKLSKGWPEFVRDNMLDE
GDVCVFELIKMGEIVLKVTIFHVVEDADPVNQIPTKNLLQVGQLGNGYDLNG
Download sequence
Identical sequences Achn232401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]