SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn240341 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn240341
Domain Number 1 Region: 99-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-33
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 913-990
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000191
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn240341
Sequence length 1038
Sequence
MKAPSNGYLSNSGEGHSEQVGCIFAFDLQMYEFLVLGSDGTFFYVYAPGRSIDAKGDRWH
PKLSQPSFQADPETDEVYAQMTLQPVSKYDQEALLLSDMGLKQSRQPAEFFCKTLTASDT
STHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDQSWTFRHIYRGWSVFVSSKRLF
AGDSILFIRCANRQQPALSSSVISSDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFV
IPLAKYNKAMYSQVSLGMRFRMMFETEESGVRRYMGTVTGISELDAVRWKNSQWRNLQVG
WDESTAGERPGRVSIWEIEPVVTPFFICPPPFFRPKFPKQPGFPDDGSDMENVFNRGMPW
LDDFGINDASSSFFPGLSLVQWMNMQQNQRFPAAQTGFFPPAGSSTPFHSNLSADDPSKL
LNFQSPALSTNLQFNKANQQAVQPHQPSLAWPQQQQLQQVLESSINSQQQQLLQQQQQQQ
QQQQQHKQQQQQLEQQPQQQQKQQMLQSALSNNNITTPNQIPNPSLQPLMYSQQQQLLTG
NTQSQQSIPSSNRNPIQLTSLPQDLQYQQQIEQASLLQRPQQHRAPPQQTPLQSLQSSLS
QIPQGQNTLQQSLSEQHLQLQLLQKLQQQQLVSQLSHSLEPQKQQAHQHNRQSQPLPLSQ
QQQQQQISGNSLSTSTFMQSTQFAANQIRDQHKLIRATSGLTDTDAPSRSTSPSTNNCGV
SPSNFLSRNQQKSFVLIEDPVVDPATAMVQELQSKSEIRIKHELPGSKGPEQQEYKGSVA
NQFDAASSATSYCLDASGFQQNFSLPSFSLDGDVQSQSRNNLAFAANFDGMAPDALLSRG
FDSGKDIQNLLSNYGGTPRDIETELSPAAISTQSFGVPNMSFKPGSSTDVAINEAGVLSG
GLCSNQSQRMRTYAKVQKRGSVGRTIDVTRYKGYDELRQDLARMFGIEGQLEDSQRTEWK
LVYVDHENDILLVGDDPWEEFVSCVQSIKILSAVEVQQMSLDGDLGHLPVPKQACSGTDS
GNVWRGHYDDNTAASFNR
Download sequence
Identical sequences Achn240341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]