SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn255601 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn255601
Domain Number 1 Region: 37-182
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-49
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 632-712
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000049
Family PB1 domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn255601
Sequence length 764
Sequence
MDEQLCAKSEDPKLLILIACAWKMDGPDSKQEQKDTYIPVELGIPSKQPTNYFCKTLTAS
DTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTT
GWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSSVLSSDSMHIGLLAAAA
HAAATNSCFTIFFNPRASPSEFVIPLSKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMG
TITGIGDLDPVRWPNSHWRTVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLK
RPWYPGASSFQDGREAAVNGMAWLRGETGEQELHSLNFQNVGMLPWTQQRVDTAFVRNDI
NQQYQAMLAAGLQNIGSGDSLKQQFLQLQQPFQYPQHSSSQNLVLQQQQQQQVIQPSISS
HILEAQTQMLPGDLPRHMQQQVNNQPEEQPQQHTYQGAFLIQSDQIQQRQQSNIPSPSFS
KTYFADSNAKFSTSVAPIQNMLGSLCADGSGNLFDFSRTGQSMLSEPSQQSWVSKFTHSQ
GNTSANSVSLPQYPGKDAAAEQENLSLNGQNHALFGANLDSGLLLPTTLSSIGTSVNANV
SSMPLGVSGFQSSLYGCMQDSPELLHSAAQVNSPSPTRTFVKVYKSGSVGRSLDITRFNS
YHELREELGQMYGIQGLFEDPMRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSP
EDVQKLGKQEVESFGHNNGERMNTSGNDARDFVSSLPSVGSLDY
Download sequence
Identical sequences Achn255601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]