SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn271111 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn271111
Domain Number 1 Region: 195-297
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-27
Family B3 DNA binding domain 0.032
Further Details:      
 
Domain Number 2 Region: 704-776
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000667
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn271111
Sequence length 830
Sequence
MVNPPTTSPLDINPTLPVQARQSHFSNKTQHFPATAKMTNAVNRSPPTTSTVNLTVVCTS
LSDTVAFRRLWPVNGDRVTCDTRCLTEATREERASLRLTAARAMAAPGKVIPADLITFLA
RFRQVMVEASTNQVSDQEMPVYNLPSKILCRVINVQLKAEPDTDEVFAQVTLLPLKEDDN
DTEKERVPPSQPRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPTQELV
AKDLHGNEWCFRHIFRGENGELRVGVRRAMRQQGNIPSSVISSHSMHLGVLATAWHAYTT
GTIFTVYYKPRTSPSEFIVPYNQYMESIKYNYSIGMRFKMRFEGEEAPEQRYTGTIVGIE
DADSRRWQESKWRCLKGVKAYMSWFKVRWDENSTVPRPERVSPWKIEPALTPATVNPLPV
PRLKRSRTSLVPCSPDSSVLTREGSSKLTIDPLPASGFTRVLQGQELSTLRGTFAESNES
DSSEKAVVWTRSVDDEKIDVVPASQRCGSDKWLPLVGPESTCTDLLSGFGTHSNSSREFC
APPIDQTPGYISSTKLNLSDQEGKFRFPQINWSVIPSGPSFNLLESSMKAPAQGSDVPYQ
TRDVRYGGFGDYSLLNGQKAEHRQGNWLMPPPVASYIQTPPHPGPGGMMPRPVLFGVSES
VQRTDQKKVVNAPDHPLPSCEQEKPSQIKDHQGKVQGGSARSCTKVHKQGIALGRSVDLT
KFSNYEEFISELDQFFEFNGELKAGTKNWLIVFTDDEGDMMLVGDDPWSEFCGMALNIYI
YTREEVKRMLPGTLSSKNEDNSLVGEGNDDKEVKNLLLSSESSPEKCSTP
Download sequence
Identical sequences Achn271111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]