SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn273801 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn273801
Domain Number 1 Region: 315-566
Classification Level Classification E-value
Superfamily Thiolase-like 5.76e-68
Family Thiolase-related 0.00000187
Further Details:      
 
Domain Number 2 Region: 529-688
Classification Level Classification E-value
Superfamily Thiolase-like 1.34e-42
Family Thiolase-related 0.00014
Further Details:      
 
Domain Number 3 Region: 790-930
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.37e-38
Family B3 DNA binding domain 0.0054
Further Details:      
 
Domain Number 4 Region: 204-297
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-19
Family Thioltransferase 0.053
Further Details:      
 
Domain Number 5 Region: 1223-1303
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000157
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn273801
Sequence length 1339
Sequence
MGCASSKPIEVAVDVYRPPPSSFAVFDINAIKEPWLMADDAHEEHKEKPTHVPVAILDKL
NKLESDGPRSWEEVSKALEDLKPKLTNPAPPPPNPAPTPPLQPPAQNSPTPAVEKPRKRP
SFHTLAELEAKISPKPSEVTRTEFKKTERVKPDSKVVSVPPPESGGYKPLRENIFIVRDK
LEREKEGKAPVKWDPLSDYPEKCPPGGSDSVVLYTTSLGGVRRTYEDSNRVRAILETHRV
VFEERDVSLHGGFRSELRELLGEGVVVPRLFVKGRYVGGAEEVVGLNETGRLGRLMSWAR
VERREAPKREMDPKKRVVITGMGLVSVFGSDVDTFYDKLLEGERGITLIDRFDASTFSVR
FAGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALDDAKLGPEVLETMDRSKIGVLVG
TGMGGLTAFSNGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYSISTACAT
ANYCFYAAANHIRRGEANIMVVGGTEAAVMPSGVGGFIACRALSQRNDEPHKASRPWDKD
RDGFVMGEGSGVLIMESLEHAMERGANVIAEYLGGAITCDAHHMTDPRSDGLGVSSCISK
ALEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKARNLNPINIYS
LAVSMIGHGLGAAGGLEAIATIKAINTGCGGDDLYKELWKACAGPLVDVPKTGERVFYFP
QGHLEQLEASTNQELNQRIPLFNLPPKILCSVMNIQLRAEQDTDEVYAQITLVPEQDQTE
PLNPVSYPPEPPRTKVHSFCKVLTASDTSTHGGFSVLRKQANECLPSLDMSQQTPTQELI
AIDLHGLEWRFKHIFRGKGQPRRHLLTTGWSTFVTSKRLVAGDTFVFMREESGELRVGVR
RVGHQQSTMPLSVISSQSMHLGVLATASHAVATGTLFVVYYKPRTSQFIIGLNKYLESVG
NKFAVGMRFKMRFEGEDSPERRFTGTIVGVENLSSHWENSKWRSLKVQWDEPASIARPER
VSPWEIEPFVASVPSSLVQPVTIKNKRPRPQIKVPVHETASAIWNPSHGPSQVSGNPEGQ
WSEPNVIWHPKQSEISSTLMNSSTSCLSKTHANGGGWQSPAHISVSRDQFADEVQDTKSP
SAWSVLSGSLTPCSGNLSSNPLSDLIDGKKIETVASCRLFGVNLKSPLKSADSSQKLDLS
KISKEYGLGQMQVLPKEVQSKQSCSSRSRTKVQMQGIAVGRAVDLTALRGYAELIAELEI
MFEIKGDLHPRNKWDIVFTDDEGDMMLLGDHPWPEFCNMVRRIFICSSQEVKKMSAESKI
SPTAADSEGTVLSLDTAET
Download sequence
Identical sequences Achn273801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]