SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn274221 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn274221
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-18
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 385-451
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000196
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn274221
Sequence length 459
Sequence
MFLPPKIARTVLHLIDQKIQLEDARGERWTVTLSKCNGSLAFEEGWRAFSLEHGLEVGDF
TLFHYIMGSRFVVQIYGKNGCERLIFSDESSSRKKRRTTRNCSAKAGRYHSIDSDSMNKQ
ASTTAVSGSNVEIRRSQPMATDNALNIDNDNERLQHSSRTIYSEEPFYMLDGDARNRQED
YRNSLYDLSNFEIQRTSAVHETNRVLVMEEVVRPLGLSDVPYITQTIENVMPIYQKVSDN
GNSLSQEQKKKTPSRNDQALISPKEENLLMHSFHSAQPKFGGVPKFSGLLASVQTQNCHS
GERMGIVKTEQAEMNKVASDLRKIVNGSYLEIKENCDKDNVCKVVKTEPVYTFELSTTEA
VNISFLMATNEQSFAELPTCLASKSFKGWLRMKRMIVVILRDPVSRLWPVIYQEKYGLKV
LTGGWEAFVKANSIRPGDKCIFKVENEFECIYRVGIVRK
Download sequence
Identical sequences Achn274221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]