SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn291361 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn291361
Domain Number 1 Region: 447-565
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.73e-17
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn291361
Sequence length 663
Sequence
METQGESIHKVNFATPRGFTTAFKSDLKETLFPDDPFHEFKNKPFSTKTKKAIQYFMPIF
EWLPKYNFRLFKYDLLAGITIASLAIPQGISYAKLANISPIIGLYSSFVPPLIYAIFGSS
KHLAVGTVAACSMLIASIIGEKVSPIENPELYLQLVFTATFFTGIIQTAMGFLRLGIIVD
FLSHSTITGFMGGTATIICLQQLKGMFGLKHFTTKTDVISVLHAIFSNRHEWRWESAVVG
IIFLVFLQFTRYVVGDLKKGINPLSINKLNFDPKYMSATLQAGIITAMVALAEGIAIGRS
FAIMKNEQVDGNKEMIAFGFMNIIGSFTSCYLTTGPFSKTAVNFNAGCKTAMSNVVMAFC
MLLTLLFLAPLFSYTPLVALSAIIMSAMLGLIEYEKAYHLFKTDKYDFCICMVGFFGVAF
ISMDIGLMLSLGSIPDSALYRDVEQYPETSGVPGILVLQLGSPIFFPNCTYIRERILRWV
RDEQANRDEGSDIEHILLDLGGVTSIEITGVETLIEVLKAMEAKGIKVALVNPRLEVMEK
LIVTKFINRIGKEKVFLSIDDAIKGCRFTLKHSKKFADINVRRRSSLPLVFSPSHARDFL
RCRRFRWICDVKALEVCGGEVGLEGRGEMGFCGETERKVAATLAAVLRERWVVAGVCCSW
TKG
Download sequence
Identical sequences Achn291361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]