SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn295121 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn295121
Domain Number 1 Region: 92-237
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.32e-49
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 681-760
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000222
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn295121
Sequence length 818
Sequence
MHVLVLLFLYLLLEAAWCISLRVIVAVSTHKEVDAHIPNYPSLPPQLICQLHNVTMHKLK
ICLLQADMETDEVYAQMTLQPLSAQEQKDASFLPADLGVLSKQPTNYFCKTLTASDTSTH
GGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTTGWSVF
VSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSDSMHLGLLAAAAHAAAT
ISRFTIFYNPRSSPSEFVISLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGI
SDLDPVRWPNSHWRSVKGIGVTPWMQPRIDASILGMQSNIYQAMAAAALQEMRAVDPSKQ
ALPSLLQFQQAQNVSGRSSGLMQPQMLQQSQPQPVFLRSVKDNQSQAQAQAQAQAQVHSQ
SHLLQQQLQRQNSFTSQHQQLQLPLSQQQQHQTQLVDHQQVSTVVSTLSPFASNSQAQSP
SLQAIASVCQQQSFSDSNGNAATNAIVSPLHSLMGSFNHDETSHLLNLPRSDTLLSSAGW
PPKRVAVDPLLPSASSQCILPQVEQLGPPHTNTSQNAISLAPFPGRECSIDQDGSNDPHN
HLLFGVNIDSSSLLMQNGMSSIRGVGTDSDSTTVHFTSSNNYLSNTGTTRTNFLLNPVMT
PSSCIDESGFLRSPENLGQANPPIRTFVKVYKSGSFGRSLDISKFSSYHELRRELARMFG
LEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPEEVHQMGKHGLEL
LNSVPIQRLSNSNCDDYSSHQESRNLSSGIASVGSLDY
Download sequence
Identical sequences Achn295121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]