SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn304511 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn304511
Domain Number 1 Region: 61-158
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000112
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn304511
Sequence length 167
Sequence
MLTIIDVQADRSGGTKKCTADCTFLRPVCTKECIKGNNSNHHMIDVGEGYQINNNSQNNE
WDIRKKLAKNDVKSYYLYIPGEPFNQKILHKMPQGHQHILTSFQLLRIIILDINTGDKFV
MLLKRFKAGYSLSDNWPSRFVQRRKLKVNDEIGLRWTNLRIHFTKFG
Download sequence
Identical sequences Achn304511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]