SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn361971 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn361971
Domain Number 1 Region: 92-237
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-48
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 669-751
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000615
Family PB1 domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn361971
Sequence length 809
Sequence
MHVLVLLFLYLLLEAAWCISLRVIVAASTHKEVDAHIPNYSSLPPQLICQLHNVTMHKLK
ICLLQADVETDEVYAQMTLQPLSAQEQKDASFLPVDLGAHSKQPTNYFCKTLTASDTSTH
GGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTTGWSVF
VSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPSSVLSSDSMHLGLLAAAAHAAAT
NSRFTIFYNPRASPSEFVISLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGI
SDLDPVRWPNSHWRSVKGIGVTPWMQPRIDASMLGMQSNIYQAMAAAALQEMRAVDPSKQ
APLSLLQFQQVQNVPGRPSGLMQPQMLQQSQPQAVFLQSVKDNQPQPQPQPHLLQQQLQH
QNAFTSQHQQLQLPLSQQQQQHQPQLVDHQQVSTVVSTPSPFASSSQAQSPSLQAIASMC
QQQSFSDSNGNTATNTIVSPLHSLMGSFSHDETSHLLNLPRSDALLSSTGWPPKRVAVDP
LLPSAASQCILPQVEQLGPPHTNTSQNAISLPPFPGRESSIDQDGSNDPHNHLLFGVSID
SSSLLMQNGMSSIRGVGSDSDSTTVHFTSSNSYLSSTGTTGTNFSLNPVMTPSSCIGESG
FLQSPENLGQANPPTRTFVKVYKSGSFGRLLDISKFSSYHELRRVLARMFGLEGQLEDPL
RSGWQLVFVDQENDVLLLGDDPWQEFVNSVWCIKILSPEEVHQMGKQGLELLNSVPIQRL
SNSNCDDYASRQESRNLSSGIASVGSLDY
Download sequence
Identical sequences Achn361971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]