SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn363641 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn363641
Domain Number 1 Region: 233-331
Classification Level Classification E-value
Superfamily TAZ domain 2.75e-22
Family TAZ domain 0.00062
Further Details:      
 
Domain Number 2 Region: 37-153
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000165
Family BTB/POZ domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn363641
Sequence length 365
Sequence
MAIEESPLGAKEIFPVPPPLPSKGVVMNGTPVRGYSCVSTATRDLWERLFDEGYRADVLI
NTDNGGIIYAHASFLGVASPVLKGVLKRSRRRGLQRSISIRGVPHDAVRVFIRFLYSSSY
EPEKLQNYVLHLLVLSHAYVVPHLKRVCECRLEQGLLTVENVIDTFQLALLCDAPRLSLI
CHRLILKNFKVVSATEGWKIMKESHPALEKEILESVVEAETRQKERARKLNERKIYLQLY
EAMEALVHICRDGCQTIGPHDKVFKENQGPCKYVMCKALELLVRHFAGCKMRVPGGCIHC
KRMWQLLELHSHLCTDSDACRVPLCRNFKRWGMKKEKKDDIKWRTLVRKVLRTKSISGTP
FFSFE
Download sequence
Identical sequences Achn363641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]