SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn376501 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn376501
Domain Number 1 Region: 63-165
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-25
Family B3 DNA binding domain 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn376501
Sequence length 204
Sequence
MQVNDLDPLAVSGVGPHGVTARENMQKYRHYQEPENSNRCHYCKELCNDTKKESLISLPG
REKLFNKVVTRSDIKQYRLAIPKHQAKKHFPPHVVSSSSNSPFLCMEDNEGKVWRFKYSF
WKSSQGYMLTNEWNQFVKEKRVSVGDMVSFFRSNGADKRLFIDWKPQNPSGIVAKSEPLE
STQNGQTVMLFGVNISTNRPNNHN
Download sequence
Identical sequences Achn376501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]