SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn376631 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn376631
Domain Number 1 Region: 713-795
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000049
Family B3 DNA binding domain 0.0083
Further Details:      
 
Domain Number 2 Region: 488-576
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000942
Family B3 DNA binding domain 0.0064
Further Details:      
 
Domain Number 3 Region: 372-464
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000432
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 4 Region: 131-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000116
Family B3 DNA binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  Achn376631
Domain Number - Region: 29-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000628
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn376631
Sequence length 795
Sequence
MLQTRGSTRRPGKEILEEDPTKVGESEPSRIFLFEMRLTESDVEQDKLCIPVEFALDHFP
PIPTLSPRCYEDYEEKRVEGFAQSHEMKAKDVVRFYTPLPCSPEKQYMRIDHVKRNPQDD
AVIRHLDCISKYFIFHHQLTYFDLNFGLLLSKVEVRKYFRDVGIPAETHNVERLYFTDAK
NTDWCMKITMFNDWYTINGPGWDQCVKDYHLEPGDFISFYRCVQPFNSRHFLIRLRKLVF
RFVLVFSRSSTKGNPSSSTSLVEIATETEGSENTIRKPSGEGNPSSLTEKMIEKMLLKPT
GEITQSESEGMKAQQEAGMEKAKDASKSGISSSSTPLKETASDTKSGESSWTRRPGKEIL
QETDPINKRDRRKIFLFEKHLTDRDVQHGVLSIPVELALDRFPPLPEILLDIFYSKIEVT
DAQGHISIMGIGYDHANSLFLIDSGWRGFAEHHGLRTMDRVRFYIPIPCLKDNVYLIEYV
RTEEFREGNFLFEKELTRDEAKYSKWLRLPPLEGRFPFPRYRIYYSERLCFTDAVNRDWW
FTFQFQNGNYCVISGWEGFRNEYKLEEGDVIKFYKAVWPRSSQYFLIQHAKRDEAARTPA
KKDGCMPNFSVLLNKAKLYVTDAANKVCRFKIMFYFNTYLVISGDNSKGVEDEDGKKLED
MKAKQEAEIEQVKDSSTPLKETATDAKSGGSTRRPGKEILEEDPTKIGESEPSRIFLFEM
RLTESDVEQDRLCIPVEFALDHFPPIPTLSPRFYEEKVNILSGTQDRVWPTTIRYDPDEC
VFLLNSGWKGFAQSH
Download sequence
Identical sequences Achn376631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]