SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427733642|ref|YP_007053186.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427733642|ref|YP_007053186.1|
Domain Number 1 Region: 821-1049
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.31e-38
Family Multidrug efflux transporter AcrB transmembrane domain 0.0018
Further Details:      
 
Domain Number 2 Region: 298-488
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.22e-37
Family Multidrug efflux transporter AcrB transmembrane domain 0.00023
Further Details:      
 
Domain Number 3 Region: 44-127
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.75e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0021
Further Details:      
 
Domain Number 4 Region: 184-265
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000129
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0039
Further Details:      
 
Domain Number 5 Region: 143-181,269-325
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000105
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0079
Further Details:      
 
Domain Number 6 Region: 734-802
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000017
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427733642|ref|YP_007053186.1|
Sequence length 1064
Comment cation/multidrug efflux pump [Rivularia sp. PCC 7116]
Sequence
MVLPFFRNVRLLILTFVLIIFWGLSAFQSLPRQEDPQLVARTGIVTTIFPGASAERVEAL
VTEVIESEMSEIEEINTITSDSRIGLSTVSIELKDTVSEAEPIWTRVRDKLADAEPQFPS
GVLEPDLDEAETRAYAVIASLVWEGKSEPNYAILRRFAQELDVQLRGVGGTEKVDTFGFP
SEEITVEINPSDLAAVGLNAQQLSQQIQQSDAKVSAGQLRSPRNTLAIEVEGELDSLERI
RQIPISSTTSGQFTRLGDIARVNRGIRQPVTDLALIGSKPAVALGVLMEPGNRIDLWAGK
IREQLEDFRQRVPNGIKLEVIFDQSSYVETRLDNLISNLLFSAFLVVAVTFVGMGWRSSL
IVGAALPLTVFAVFGELQIFNIPIHQMSVSGLIIALGLLIDNAIVVVDEIQVELEHGLKP
KDAVVKTVNYLTVPLLTSSLTTILTFLPIGLLPGGAGEFVGSIAWGVIMSLVSSLVISLT
VIAALSGRFLAQTQVDEEDIRPKRKSRKSRLLSRLLSTIKNPHAWWNSGLSSPFLGRIYR
KTLNWATAKPLIAIVLTMILPVMGFINVSSLPTQFFPSLNRDQFQIEVEFPAQTSIAQSR
EDVLLARKLIQEHSQVEEVHWFVGESAPKFYYNFTGGMKNAAYYAQAMVQLNTDKGVMQL
IRTLQDELDSAFPSARVLVKQLEQGPPFEAPVEMRIFGPDIAELRRLGVQVREILTQIPD
VTHARDDLTETLPKLGLEVDEEQARLVGLDNRAIAQQLETYLEGSVGGSILESTENLPVR
VRIANSNRGDLSQIASLNLQPTQQTGTEPNLRPLSALGKFNLVPQLASISRRNEQRVNTV
QAFISAGVLPSVVLGELQQRLQAQEFESKLPPGYRYEFGGEQAESGEATGNLMSTVGLLG
LIMVITLVLSLGSFRMAGIVFAVGAGSVGLALFALWAFDSVFGFMAIVGTMGLIGIAING
AIIILSAFNEDEAAKNGDVKAVREVVVKATRHVLTTTITTMVGFIPLIADGDPFWLPLAI
AIAGGIGGSPLLALYFTPAAYLLVKGRRKNTRKRKQLLLPPAVS
Download sequence
Identical sequences K9R5L2
WP_015116217.1.44015 gi|427733642|ref|YP_007053186.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]