SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427733731|ref|YP_007053275.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427733731|ref|YP_007053275.1|
Domain Number 1 Region: 296-543
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.66e-40
Family ABC transporter ATPase domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 68-283
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.7e-18
Family DNA repair protein MutS, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 744-816
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000641
Family Smr domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427733731|ref|YP_007053275.1|
Sequence length 817
Comment MutS2 family protein [Rivularia sp. PCC 7116]
Sequence
MIQSETLELLEWSRLCQHLSTFAATKLGAIAARNIAIPDSQVESEYLLAQTKEVYELENR
LDNGISFEGIQDFGDSLERAELKGILAGDELLAIATTLAGIRNLRRLIDNHPDLEILNEL
VADLRTYPELEKEIHRCIDERGQVTDRASEKLGDIRNSLRQSRSQITRKLQNIIQVKANA
LQETIITQRSDRFVIPVKAPQKDAIPGIVHDTSTSGATLYVEPNSIVPMGNQLRQLLRRE
QVEEEAIRRKLSEQVAEVKLDLEKLLAVATTLDLATAKARYSFWLKANPPRFIQPSEENI
TLRELRHPLLVWQQQHEQGHEVIPVNLVIHPYIRVVTITGPNTGGKTVTLKTLGFATLMA
KIGLFVPAREPVELPWFDRVLADIGDEQSLEQSLSTFSGHIRRISRILDAVSHVKVEEAQ
TAEKAEQEENTSLPSPTPSSLVLLDEVGAGTDPVEGSALAIALLRYLADNSMLTIATTHF
GELKALKYQDERFENASVEFDEATLSPTYRLLWGIPGRSNALAIASRLGLKPEVVEKAKD
EMGGATDEVNQVIAGLEAQRRRQEEKATQAQDLLQQAERFYKEVSAKAADLEEREKSLRA
SQEIAVQQAIASAKGEIAAVIKRLQQGNPTAQDAKKATDSINKLADRFIPKAEPKPKAGF
MPKVGERIRIPKLGQTAEVLTAPDEDGEFNVRFGIMKMTVKLKDVESLSGEKAQPSAKAK
PAAKIAPAPPPPVENTPLIRTSKNTVDLRGRRVADAELVLDKAISEAQRAIWIIHGHGTG
KLRQGVHAYLKQNPRISNYEAAPQNDGGTGVTIAYIK
Download sequence
Identical sequences K9R5D1
WP_015116306.1.44015 gi|427733731|ref|YP_007053275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]