SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427733787|ref|YP_007053331.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427733787|ref|YP_007053331.1|
Domain Number - Region: 85-180
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0235
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427733787|ref|YP_007053331.1|
Sequence length 184
Comment hypothetical protein Riv7116_0176 [Rivularia sp. PCC 7116]
Sequence
MKNKLLFSGAIIIALFNLTGCGQDNANTETLAPVETTSQNNQETQISQPLSTTAETPEVP
VSTSKPAKTASNQTNNSATYDDNRGNRTIRIKFDIGTSSKTVKDSVVRGTRDIYLLGANT
GQQMNLNIASLEDNAVFDVISPNGQILQQETKNWSGKLPQNGDYQIVVGGTRGNATYELA
TEIK
Download sequence
Identical sequences K9R601
gi|427733787|ref|YP_007053331.1| WP_015116362.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]