SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427733824|ref|YP_007053368.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427733824|ref|YP_007053368.1|
Domain Number 1 Region: 9-85,181-348
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.82e-47
Family Bacterial dinuclear zinc exopeptidases 0.0056
Further Details:      
 
Domain Number 2 Region: 75-189
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.000000000000366
Family Aminopeptidase/glucanase lid domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427733824|ref|YP_007053368.1|
Sequence length 350
Comment peptidase family protein [Rivularia sp. PCC 7116]
Sequence
MSDSDYEQLFQTIESLVMHHSPSGAETEINQYLMQRFQNLGVEVWQDRADNIIAKIPGKK
SDYPIAITAHKDEIGAIVKTVGEAGIVEVRKLGGAFPWVYGEGVVDLLGDKETISGVLSF
GSRHVSHESPQKMFQQDVALKWEDAWIETKCSALELENAGIRPGSRMVISKHRKHPIRLK
DHIASYTLDNKASVAILLALAEKVKQPAVDVYLVASAKEEVGAIGALYFSQNQRLDAIIA
LEICPLSSEYPIEDGESPVILSQDSYGIYDENLNGQLRNCAKQLDMPVQLATLSQFGSDA
SIAMKFGHVPRGACLSFPTQNTHGYEIAHLGAIANCIDLLKEFCESMDSG
Download sequence
Identical sequences K9R5U0
WP_015116399.1.44015 gi|427733824|ref|YP_007053368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]